PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 341aa    MW: 39293.4 Da    PI: 7.5591
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1202genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W++I++  g+ R++k+c++rw +yl
      Gh_D12G1202 14 KGLWSPEEDEKLLRHITKYGHGCWSSIPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding40.47e-1367145146
                      TSSS-HHHHHHHHHHHHHTTTT..................................-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..................................tWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l++++++ lG++                                  +W+ Ia++++ gRt++++k+ w++
      Gh_D12G1202  67 RGTFSQEEENLIIELHAVLGNRyihihihshiyicffffflldflwrilgfsrfsiRWSQIAARLP-GRTDNEIKNLWNS 145
                      899***************************************************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-28564IPR009057Homeodomain-like
PROSITE profilePS5129425.599965IPR017930Myb domain
SMARTSM007178.2E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
SuperFamilySSF466893.43E-231692IPR009057Homeodomain-like
CDDcd001671.14E-111761No hitNo description
PROSITE profilePS500908.87362147IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.5E-226587IPR009057Homeodomain-like
SMARTSM007171.3E-766149IPR001005SANT/Myb domain
PfamPF002491.6E-1067146IPR001005SANT/Myb domain
CDDcd001671.91E-469144No hitNo description
SuperFamilySSF466894.11E-8120156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-22123152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRQSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSI PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNRYI HIHIHSHIYI CFFFFFLLDF LWRILGFSRF  120
SIRWSQIAAR LPGRTDNEIK NLWNSCLKKK LKQKGIDPVT HKPLSEVENG EGNRSNKPSL  180
VGHHPIHQYT SPPPPPPKLS SNWFNPEFSP PMTASYGPLY YGTTTGGSAN NTTWGLVQTQ  240
TEEEEEEEEE EEETKWTELL NSPLLMAAAL QNQTPQSYYN IEIKSEPCYL TNSSSSSSSS  300
NDMWWPQTQQ QQLPLRHEPL QNPDICGKDM QTLTAAAFGH I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-221215125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146152LKKKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.75220.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9083440.0DQ908344.1 Gossypium hirsutum clone LIB5327-004-A1-N1-E10_Gh405 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437875.11e-179PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D2T5G90.0A0A0D2T5G9_G
STRINGGLYMA10G27940.13e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.39e-83myb domain protein 55